Recombinant Rat Pdgfb protein

• Cat.No.: Pdgfb-975R
• Product Overview: Recombinant Rat Pdgfb protein was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 109
• Description: This protein may play a role in carotid artery smooth muscle cell proliferation and neointimal formation in response to balloon catheter injury.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 1 × PBS, pH 6.9.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 2.0 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 24.4 kDa, a disulfide-linked homodimeric protein containing two 109 amino acid residues polypeptide (B chain).
• AA Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT
• Endotoxin: Less than 0.1 EU/μg of rRtPDGF-BB as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Pdgfb
• Official Symbol: Pdgfb
• Synonyms: PDGFB; platelet-derived growth factor beta polypeptide; platelet-derived growth factor subunit B; PDGF-2; pdgf protein; PDGF subunit B; platelet-derived growth factor B chain; platelet derived growth factor, B polypeptide; Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; c-sis
• Gene ID: 24628
• mRNA Refseq: NM_031524
• Protein Refseq: NP_113712
• UniProt ID: Q05028