Active Recombinant Human PAK4

• Cat.No.: PAK4-18H
• Product Overview: PAK4KD is a recombinant wild type human PAK4 kinase domain (amino acids 300–591 of full-length human PAK4) expressed in E. coli and purified to homogeneity with full activity.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Human PAK4 kinase (UniProt: O96013; NCBI: NM_005884) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton.
• Form: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
• Bio-activity: 5,595 pmoles/min/μg
• Molecular Mass: The calculated mass is 33,309. PAK4KD is fully phosphorylated at S474 with a measured mass of 33,389 (1P).
• AA Sequence: GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSD SILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNE PPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
• Applications: Enzymatic studies, inhibitor screen, and selectivity profiling
• Storage: Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.

Gene Information

• Gene Name: PAK4 p21 protein (Cdc42/Rac)-activated kinase 4 [ Homo sapiens ]
• Official Symbol: PAK4
• Synonyms: PAK4; p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A) activated kinase 4; serine/threonine-protein kinase PAK 4; PAK-4; p21-activated kinase 4; p21(CDKN1A)-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
• Gene ID: 10298
• mRNA Refseq: NM_001014831
• Protein Refseq: NP_001014831
• MIM: 605451
• UniProt ID: O96013
• Chromosome Location: 19p11-q11
• Pathway: Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem
• Function: ATP binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity