Active Recombinant Human Interferon, Gamma

• Cat.No.: IFNG-26H
• Product Overview: Recombinant Human Interferon encoding the full-length human Interferon-gamma (IFN-g) protein was expressed in modifiedhuman 293 cells.

Specification

• Cat. No.: IFNG-26H
• Description: Interferon-gamma (IFN-gamma) is a type II interferon and is expressed predominantly by CD8+ and CD4+ T cells, and natural killer (NK) cells. IFN-gamma acts as a potent activator of antigen presenting cells as well as inducing expression of IL-12, which in turn promotes a TH1 cell mediated immune response for clearing of viral and microbial infections. IFN-gamma activates non-specific tumoricidal activity in macrophages in addition to enhancing the cytotoxicity of NK cells. IFN-gamma can also directly inhibit proliferation of transformed cells or potentiate the antiviral and anti-tumor effects of the type I interferons.
• Source: Human 293 cells.
• Amino Acid Sequence: CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ.
• Molecular Mass: IFN-gamma migrates as a band between 20 and 25 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IFN-gamma that has a predicted molecular mass of 17.1 kDa.
• pI: IFN-gamma separates into a number of glycoforms with a pI between 6 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation.
• % Carbohydrate: IFN-gamma consists of 10-30% carbohydrate by weight.
• Glycosylation: IFN-gamma has N-linked and possibly O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED50 of IFN-gamma is typically 0.01 - 0.02 ng/ml as measured in a cell prolipheration assay using the human growth factor-dependant M-07e cell line.
• Tag: Non

Gene Information

• Gene Name: IFNG interferon, gamma [ Homo sapiens ]
• Synonyms: IFNG; interferon, gamma; IFG; IFI; IFN-gamma; Immune interferon; interferon, gamma
• Gene ID: 3458
• mRNA Refseq: NM_000619
• Protein Refseq: NP_000610
• UniProt ID: P01579
• Chromosome Location: 12q14
• MIM: 147570
• Pathway: Allograft rejection; Cytokine-cytokine receptor interaction; Graft-versus-host disease; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Proteasome; Regulation of autophagy; Systemic lupus erythematosus; cell receptor signaling pathway; TGF-beta signaling pathway; Type I diabetes mellitus
• Function: cytokine activity; interferon-gamma receptor binding