Active Recombinant Human Interferon, Gamma

Cat.No. : IFNG-26H
Product Overview : Recombinant Human Interferon encoding the full-length human Interferon-gamma (IFN-g) protein was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Interferon-gamma (IFN-gamma) is a type II interferon and is expressed predominantly by CD8+ and CD4+ T cells, and natural killer (NK) cells. IFN-gamma acts as a potent activator of antigen presenting cells as well as inducing expression of IL-12, which in turn promotes a TH1 cell mediated immune response for clearing of viral and microbial infections. IFN-gamma activates non-specific tumoricidal activity in macrophages in addition to enhancing the cytotoxicity of NK cells. IFN-gamma can also directly inhibit proliferation of transformed cells or potentiate the antiviral and anti-tumor effects of the type I interferons.
Amino Acid Sequence : CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ.
Molecular Mass : IFN-gamma migrates as a band between 20 and 25 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IFN-gamma that has a predicted molecular mass of 17.1 kDa.
pI : IFN-gamma separates into a number of glycoforms with a pI between 6 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate : IFN-gamma consists of 10-30% carbohydrate by weight.
Glycosylation : IFN-gamma has N-linked and possibly O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50 of IFN-gamma is typically 0.01 - 0.02 ng/ml as measured in a cell prolipheration assay using the human growth factor-dependant M-07e cell line.
Gene Name IFNG interferon, gamma [ Homo sapiens ]
Synonyms IFNG; interferon, gamma; IFG; IFI; IFN-gamma; Immune interferon; interferon, gamma
Gene ID 3458
mRNA Refseq NM_000619
Protein Refseq NP_000610
UniProt ID P01579
Chromosome Location 12q14
MIM 147570
Pathway Allograft rejection; Cytokine-cytokine receptor interaction; Graft-versus-host disease; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Proteasome; Regulation of autophagy; Systemic lupus erythematosus; cell receptor signaling pathway; TGF-beta signaling pathway; Type I diabetes mellitus
Function cytokine activity; interferon-gamma receptor binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon