Recombinant Rat Ifng protein

• Cat.No.: Ifng-115R
• Product Overview: Recombinant Rat Ifng protein was expressed in Escherichia coli.

Specification

• Description: Interferon-gamma (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. It shares high sequence indentity with mouse IFN-γ (86 %). IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. Additionally, IFN-γ augments TH1 cell expansion and may be required for TH1 cell differentiation.
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4, 1 mM DTT, 5 % Trehalose and 0.05 % Tween-80.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using murine L929 cells infected with encephalomyocarditis (EMC) virus is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg.
• Molecular Mass: Approximately 15.5 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
• Protein length: 134
• AA Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
• Endotoxin: Less than 0.1 EU/µg of rRtIFN-γ as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Ifng
• Official Symbol: Ifng
• Synonyms: IFNG; interferon gamma; IFN-gamma; IFNG2
• Gene ID: 25712
• mRNA Refseq: NM_138880
• Protein Refseq: NP_620235
• UniProt ID: P01581