Specification
Gene Information
Related Products
Download

Description :	Interferon-γ (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.
Source :	CHO
Species :	Rat
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 2.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of > 4 × 10^5 units/mg.
Molecular Mass :	15-25 kDa, observed by non-reducing SDS-PAGE.
AA Sequence :	QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE and HPLC.
Storage :	Lyophilized recombinant Rat Interferon gamma (IFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	Ifng interferon gamma [ Rattus norvegicus ]
Official Symbol	Ifng
Synonyms	IFNG; interferon gamma; IFN-gamma; IFNG2;
Gene ID	25712
mRNA Refseq	NM_138880
Protein Refseq	NP_620235
UniProt ID	P01581