| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
76 |
| Description : |
Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro‑BNP (NT-pro-BNP) and mature BNP. Plasma NT-proBNP is a marker for congestive heart failure, while mature BNP (aa 103‑134) promotes vasodilation and fluid and sodium excretion. Human BNP precursor shares 29% and 51% aa sequence identity with mouse and porcine BNP precursor, respectively. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 150mM NaCl. |
| Molecular Mass : |
Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids. |
| AA Sequence : |
HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
| Endotoxin : |
Less than 0.1 EU/μg of rHuNT-pro-BNP as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
