Recombinant Full Length Human NPPB Protein, GST-tagged

• Cat.No.: NPPB-6643HF
• Product Overview: Human NPPB full-length ORF ( AAH25785, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 134 amino acids
• Description: This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The proteins biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq
• Molecular Mass: 40.48 kDa
• AA Sequence: MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDSETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860