Recombinant Rhesus Macaque S100 Calcium Binding Protein B

• Cat.No.: S100B-5482R
• Product Overview: Recombinant Rhesusmacaque S100 calcium binding protein B is a single, non-glycosylatedpolypeptide chain containing 92 amino acids.

Specification

• Cat. No.: S100B-5482R
• Description: S100B isglial-specific and is expressed primarily by astrocytes. Not all astrocytes expressS100B. It has been shown that S100B is only expressed by a subtype of mature astrocytesthat ensheath blood vessels and by NG2-expressing cells. This protein mayfunction in neurite extension,proliferation of melanoma cells, stimulation ofCa2+ fluxes,inhibition of PKC-mediatedphosphorylation,astrocytosis and axonal proliferation, and inhibition ofmicrotubule assembly. In the developing CNS, it acts as a neurotrophic factorand neuronal survival protein.
• Source: E. coli
• Species: Rhesus Macaque
• Form: Lyophilized from a0.2μm filtered concentrated solution in PBS, pH 7.4.
• Purity: >97%by SDS-PAGEand HPLC analyses
• Endotoxin Level: <0.1 ng/μg ofprotein.
• Amino Acid Sequence: MSELEKAMVALIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKEQEVVDKVMETLDSDGDGECD FQEFMAFVAM VTTACHEFFE HE
• Molecular Weight: 10.7 kDa
• Reconstitution: Centrifuge vialprior to opening.Reconstitute in sterile distilled water or aqueous buffercontaining 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutionsshould be divided into working aliquots and stored at -80°C. Furtherdilutions should be made in appropriate buffered solutions.
• Storage: The lyophilizedprotein is stable at 2-4°C, but should be kept desiccated at -20°C for long termstorage. After reconstitution, the protein is stable for 1 week at 2-4°C. Forlong term storage, aliquot and freeze at -80°C. Avoid repeated freeze-thawcycles.
• OfficialSymbol: S100B
• Tag: Non

Gene Information

• Gene Name: S100B S100 calcium bindingprotein B [ Macaca mulatta ]
• Synonyms: S100B;S100 calcium binding protein B
• Gene ID: 708117
• mRNA Refseq: XM_001098016
• Protein Refseq: XP_001098016
• UniProt ID: F7ANQ9