Recombinant Mouse S100b protein, His&Myc-tagged

• Cat.No.: S100b-6312M
• Product Overview: Recombinant Mouse S100b protein(P50114)(2-92aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: His&Myc
• Protein length: 2-92a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.0 kDa
• AASequence: SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: S100b S100 protein, beta polypeptide, neural [ Mus musculus ]
• Official Symbol: S100b
• Synonyms: S100B; S100 protein, beta polypeptide, neural; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; Bpb; AI850290; MGC74317
• Gene ID: 20203
• mRNA Refseq: NM_009115
• Protein Refseq: NP_033141