Recombinant Rat Tnfsf13 Protein

• Cat.No.: Tnfsf13-16R
• Product Overview: Rat APRIL was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Rat
• Source: Yeast
• Description: Tumor necrosis factor ligand superfamily member 13 (TNFSF13) also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family.
• Molecular Mass: 16.4 kDa
• AA Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL(146)
• Applications: Cell culture, as an ELISA Standard, and as a Western Blot Control.

Gene Information

• Gene Name: Tnfsf13 TNF superfamily member 13 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Tnfsf13
• Synonyms: Tnfsf13; TNF superfamily member 13; April; Tnlg7b; tumor necrosis factor ligand superfamily member 13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand 7b; tumor necrosis factor superfamily member 13
• Gene ID: 287437
• mRNA Refseq: NM_001009623
• Protein Refseq: NP_001009623
• UniProt ID: Q5PQL1