Recombinant Mouse Tnfsf13 protein

• Cat.No.: Tnfsf13-933M
• Product Overview: Recombinant Mouse Tnfsf13 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 146
• Description: The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.02 % Tween-20.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using activated T cells.
• Molecular Mass: Approximately 16.4 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
• AA Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
• Endotoxin: Less than 0.1 EU/µg of rMusAPRIL/TNFSF13 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Tnfsf13
• Official Symbol: Tnfsf13
• Synonyms: TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; a proliferation-inducing ligand; April; Tall2; Trdl1; 2310026N09Rik; MGC106105
• Gene ID: 69583
• mRNA Refseq: NM_001159505
• Protein Refseq: NP_001152977
• UniProt ID: Q9D777