Active Recombinant Mouse Tnfsf13 Protein (192 aa)

• Cat.No.: Tnfsf13-440T
• Product Overview: Recombinant mouse A Proliferation-inducing Ligand (rmApril) produced in E. coli is a single non-glycosylated polypeptide chain containing 192 amino acids. A fully biologically active molecule, rmApril has a molecular mass of 21.9kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 192
• Description: A Proliferation-inducing Ligand (April)) also known as TNSF13A, Tall-2, and TRDL-1, is a member of the TNF ligand (TNFL) superfamily. April is most similar to B-cell activation factor (BAFF) with which it shares 30% sequence identity, compete for two receptors, TACI and BCMA. APRIL is expressed at low levels in lymphoid tissue and is over-expressed by a number of tumors. April has a proliferative effect on both normal and tumor cell lines in vitro and in vivo. APRIL seems to be involved in the regulation of death and proliferation of tumor cells, but there are still contradictory findings regarding its overall biological effects.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Measured by its ability to induce cell proliferation of RPMI 8226 Cells.
• Molecular Mass: 21.9kDa, observed by reducing SDS-PAGE.
• AA Sequence: MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses
• Storage: Lyophilized recombinant mouse A Proliferation-inducing Ligand (rmApril) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmApril should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 20mM acetic acid.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Tnfsf13 tumor necrosis factor (ligand) superfamily, member 13 [ Mus musculus ]
• Official Symbol: Tnfsf13
• Synonyms: TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; a proliferation-inducing ligand; April; Tall2; Trdl1; 2310026N09Rik; MGC106105
• Gene ID: 69583
• mRNA Refseq: NM_001159505
• Protein Refseq: NP_001152977
• UniProt ID: Q9D777