Recombinant Rat Snca Protein

• Cat.No.: Snca-387R
• Product Overview: Recombinant Rat Snca(1-140 aa) was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 1-140 aa
• Description: SNCA is associated with human neurodegenerative diseases, where it forms aggregates in nerve tissues. Diseases include Parkinson’s disease, dementia with lewy bodies, and multi-system atrophy, but also other’s disease like Alzheimer’s Disease. Lewy Bodies are well-known cytoplasmic deposits of SNCA in Parkinson’s disease.
• Form: Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 2.5 mg/ml
• Molecular Mass: 14629 kg/mol
• AA Sequence: GSMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
• Purity: > 98% by SDS-PAGE
• Notes: Thawing: Gentle agitation at 37 centigrade. Refreezing is not recommended and should be avoided.
• Storage: Store at -80 centigrade
• Concentration: 2.5 mg/ml

Gene Information

• Gene Name: Snca synuclein, alpha (non A4 component of amyloid precursor) [ Rattus norvegicus ]
• Official Symbol: Snca
• Synonyms: SNCA; synuclein, alpha (non A4 component of amyloid precursor); alpha-synuclein; MGC105443
• Gene ID: 29219
• mRNA Refseq: NM_019169
• Protein Refseq: NP_062042
• UniProt ID: P37377