Recombinant Rat Snca Protein

Cat.No. : Snca-387R
Product Overview : Recombinant Rat Snca(1-140 aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : SNCA is associated with human neurodegenerative diseases, where it forms aggregates in nerve tissues. Diseases include Parkinson’s disease, dementia with lewy bodies, and multi-system atrophy, but also other’s disease like Alzheimer’s Disease. Lewy Bodies are well-known cytoplasmic deposits of SNCA in Parkinson’s disease.
Source : E. coli
Species : Rat
Form : Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 2.5 mg/ml
Molecular Mass : 14629 kg/mol
Protein length : 1-140 aa
AA Sequence : GSMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Purity : > 98% by SDS-PAGE
Notes : Thawing: Gentle agitation at 37 centigrade. Refreezing is not recommended and should be avoided.
Storage : Store at -80 centigrade
Concentration : 2.5 mg/ml
Tag : Non
Gene Name Snca synuclein, alpha (non A4 component of amyloid precursor) [ Rattus norvegicus ]
Official Symbol Snca
Synonyms SNCA; synuclein, alpha (non A4 component of amyloid precursor); alpha-synuclein; MGC105443;
Gene ID 29219
mRNA Refseq NM_019169
Protein Refseq NP_062042
UniProt ID P37377

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Snca Products

Required fields are marked with *

My Review for All Snca Products

Required fields are marked with *

0

Inquiry Basket

cartIcon