Recombinant Human SNCA protein(11-110 aa), C-His-tagged

Cat.No. : SNCA-2744H
Product Overview : Recombinant Human SNCA protein(P37840)(11-110 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-110 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQE
Gene Name SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ]
Official Symbol SNCA
Synonyms SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988;
Gene ID 6622
mRNA Refseq NM_000345
Protein Refseq NP_000336
MIM 163890
UniProt ID P37840

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNCA Products

Required fields are marked with *

My Review for All SNCA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon