Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNCA-5970H |
Product Overview : | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. |
Molecular Mass : | 11.2 kDa |
AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNCA synuclein alpha [ Homo sapiens (human) ] |
Official Symbol | SNCA |
Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
Gene ID | 6622 |
mRNA Refseq | NM_007308 |
Protein Refseq | NP_009292 |
MIM | 163890 |
UniProt ID | P37840 |
◆ Recombinant Proteins | ||
SNCA-02H | Recombinant Human SNCA Protein | +Inquiry |
SNCA-7034H | Recombinant Human SNCA, None tagged | +Inquiry |
SNCA-77H | Recombinant Human SNCA, A53T Mutant | +Inquiry |
SNCA-235H | Recombinant Human SNCA protein | +Inquiry |
SNCA-292H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 96-140 | +Inquiry |
◆ Native Proteins | ||
SNCA-27342TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *
0
Inquiry Basket