Recombinant Rat Scgb1a1 protein
Cat.No. : | Scgb1a1-1395R |
Product Overview : | Recombinant Rat Scgb1a1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 77 |
Description : | This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/mg. |
Molecular Mass : | Approximately 17.0 kDa, a homodimeric protein consisting of two 77 amino acid non-glycosylated polypeptide chains. |
AA Sequence : | SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV |
Endotoxin : | Less than 1 EU/μg of rRtUteroglobin as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Scgb1a1 |
Official Symbol | Scgb1a1 |
Synonyms | SCGB1A1; secretoglobin, family 1A, member 1 (uteroglobin); uteroglobin; CCPBP; PCB-binding protein; secretoglobin family 1A member 1; clara cells 10 kDa secretory protein; clara cell phospholipid-binding protein; Uteroglobin (Clara cell secretory protein); Ugb; CC10; CCSP; PCBB; |
Gene ID | 25575 |
mRNA Refseq | NM_013051 |
Protein Refseq | NP_037183 |
UniProt ID | P17559 |
◆ Recombinant Proteins | ||
Scgb1a1-7838M | Recombinant Mouse Scgb1a1 protein, His-tagged | +Inquiry |
SCGB1A1-4911R | Recombinant Rat SCGB1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCGB1A1-1429H | Recombinant Human SCGB1A1 protein, His-GST-tagged | +Inquiry |
SCGB1A1-29817TH | Recombinant Human SCGB1A1 | +Inquiry |
SCGB1A1-464H | Recombinant Human SCGB1A1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCGB1A1-1891HCL | Recombinant Human SCGB1A1 cell lysate | +Inquiry |
SCGB1A1-1794MCL | Recombinant Mouse SCGB1A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Scgb1a1 Products
Required fields are marked with *
My Review for All Scgb1a1 Products
Required fields are marked with *
0
Inquiry Basket