Recombinant Rat PRSS1 Protein (24–246 aa), His-tagged

• Cat.No.: PRSS1-1494R
• Product Overview: Recombinant Rat PRSS1 Protein (24–246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Source: Yeast
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 23.1 kDa
• Protein length: 24–246 aa
• AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ]
• Official Symbol: PRSS1
• Synonyms: PRSS1; pretrypsinogen I; Try1; PTRYI; RATPTRYI
• Gene ID: 24691
• mRNA Refseq: NM_012635
• Protein Refseq: NP_036767
• UniProt ID: P00762