Recombinant Rat Prss1 protein, His-tagged

• Cat.No.: Prss1-3374R
• Product Overview: Recombinant Rat Prss1 protein(P00762)(24-246aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 24-246aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.2 kDa
• AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ]
• Official Symbol: Prss1
• Synonyms: PRSS1; protease, serine, 1 (trypsin 1); anionic trypsin-1; pretrypsinogen I; anionic trypsin I; serine protease 1; protease, serine, 2; pancreatic trypsin 1; Try1; PTRYI; RATPTRYI
• Gene ID: 24691
• mRNA Refseq: NM_012635
• Protein Refseq: NP_036767