Recombinant Rat Prss1 protein, His-tagged
Cat.No. : | Prss1-3374R |
Product Overview : | Recombinant Rat Prss1 protein(P00762)(24-246aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-246aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.2 kDa |
AA Sequence : | IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ] |
Official Symbol | Prss1 |
Synonyms | PRSS1; protease, serine, 1 (trypsin 1); anionic trypsin-1; pretrypsinogen I; anionic trypsin I; serine protease 1; protease, serine, 2; pancreatic trypsin 1; Try1; PTRYI; RATPTRYI; |
Gene ID | 24691 |
mRNA Refseq | NM_012635 |
Protein Refseq | NP_036767 |
◆ Recombinant Proteins | ||
Prss1-3374R | Recombinant Rat Prss1 protein, His-tagged | +Inquiry |
PRSS1-746R | Recombinant Rat PRSS1 Protein (24-246 aa), His-SUMO-tagged | +Inquiry |
PRSS1-5894H | Recombinant Human PRSS1 protein, Fc/His-tagged | +Inquiry |
PRSS1-516H | Active Recombinant Human PRSS1 Protein, His-tagged | +Inquiry |
PRSS1-3925H | Recombinant Human PRSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS1-2806HCL | Recombinant Human PRSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prss1 Products
Required fields are marked with *
My Review for All Prss1 Products
Required fields are marked with *
0
Inquiry Basket