Recombinant Rat MMP7 Protein (98-267 aa), His-tagged

• Cat.No.: MMP7-1458R
• Product Overview: Recombinant Rat MMP7 Protein (98-267 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• ProteinLength: 98-267 aa
• Description: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.9 kDa
• AA Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Mmp7 matrix metallopeptidase 7 [ Rattus norvegicus ]
• Official Symbol: MMP7
• Synonyms: MMP7; matrilysin; MMP-7; matrin; pump-1 protease; MPMM
• Gene ID: 25335
• mRNA Refseq: NM_012864
• Protein Refseq: NP_036996
• UniProt ID: P50280