Recombinant Human MMP7 protein(18-267 aa), N-SUMO & C-His-tagged

Cat.No. : MMP7-2612H
Product Overview : Recombinant Human MMP7 protein(P09237)(18-267 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 18-267 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Gene Name MMP7 matrix metallopeptidase 7 (matrilysin, uterine) [ Homo sapiens ]
Official Symbol MMP7
Synonyms MMP7; matrix metallopeptidase 7 (matrilysin, uterine); matrix metalloproteinase 7 (matrilysin, uterine) , MPSL1; matrilysin; PUMP 1; matrin; pump-1 protease; uterine matrilysin; uterine metalloproteinase; matrix metalloproteinase-7; matrix metalloproteinase 7 (matrilysin, uterine); MMP-7; MPSL1; PUMP-1;
Gene ID 4316
mRNA Refseq NM_002423
Protein Refseq NP_002414
MIM 178990
UniProt ID P09237

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMP7 Products

Required fields are marked with *

My Review for All MMP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon