Recombinant Rat Kcne2 protein, His-tagged
Cat.No. : | Kcne2-3130R |
Product Overview : | Recombinant Rat Kcne2 protein(P63161)(1-123aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-123aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.4 kDa |
AA Sequence : | MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Kcne2 potassium voltage-gated channel, Isk-related family, member 2 [ Rattus norvegicus ] |
Official Symbol | Kcne2 |
Synonyms | KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; minK-related peptide 1; potassium channel subunit beta MiRP1; minimum potassium ion channel-related peptide 1; potassium voltage-gated channel, Isk-related subfamily, gene 2; Mirp1; MGC108602; |
Gene ID | 171138 |
mRNA Refseq | NM_133603 |
Protein Refseq | NP_598287 |
◆ Recombinant Proteins | ||
KCNE2-240H | Recombinant Human KCNE2 Full Length Transmembrane protein, His-tagged | +Inquiry |
KCNE2-8492M | Recombinant Mouse KCNE2 Protein | +Inquiry |
Kcne2-3130R | Recombinant Rat Kcne2 protein, His-tagged | +Inquiry |
KCNE2-2834R | Recombinant Rat KCNE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36210RF | Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily E Member 2(Kcne2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNE2-5065HCL | Recombinant Human KCNE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcne2 Products
Required fields are marked with *
My Review for All Kcne2 Products
Required fields are marked with *
0
Inquiry Basket