Recombinant Rat Kcne2 protein, His-tagged

• Cat.No.: Kcne2-3130R
• Product Overview: Recombinant Rat Kcne2 protein(P63161)(1-123aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 1-123aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.4 kDa
• AA Sequence: MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Kcne2 potassium voltage-gated channel, Isk-related family, member 2 [ Rattus norvegicus ]
• Official Symbol: Kcne2
• Synonyms: KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; minK-related peptide 1; potassium channel subunit beta MiRP1; minimum potassium ion channel-related peptide 1; potassium voltage-gated channel, Isk-related subfamily, gene 2; Mirp1; MGC108602
• Gene ID: 171138
• mRNA Refseq: NM_133603
• Protein Refseq: NP_598287