Recombinant Human KCNE2 Full Length Transmembrane protein, His-tagged

• Cat.No.: KCNE2-240H
• Product Overview: Recombinant Human KCNE2 protein, fused to His-tag, was expressed in E.coli and purified by Ni-sepharose.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-123aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.3 kDa
• AA Sequence: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: KCNE2 potassium voltage-gated channel, Isk-related family, member 2 [ Homo sapiens ]
• Official Symbol: KCNE2
• Synonyms: KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; MiRP1; minK-related peptide 1; minK-related peptide-1; potassium channel subunit, MiRP1; potassium channel subunit beta MiRP1; voltage-gated K+ channel subunit MIRP1; minimum potassium ion channel-related peptide 1; cardiac voltage-gated potassium channel accessory subunit 2; LQT5; LQT6; ATFB4; MIRP1; MGC138292
• Gene ID: 9992
• mRNA Refseq: NM_172201
• Protein Refseq: NP_751951
• MIM: 603796
• UniProt ID: Q9Y6J6