Recombinant Rat Il17a protein

• Cat.No.: Il17a-489R
• Product Overview: Recombinant Rat Il17a protein was expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Protein Length: 133
• Description: Cytokine; may be involved in immune system function or to cell death and cell survival.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 6.5.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 30.0 kDa, a disulfide-linked homodimer of two 133 amino acid polypeptide chains.
• AA Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
• Endotoxin: Less than 0.1 EU/µg of rRtIL-17A as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il17a
• Official Symbol: Il17a
• Synonyms: IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); Il17; IL-17; CTLA-8; IL-17A
• Gene ID: 301289
• mRNA Refseq: NM_001106897
• Protein Refseq: NP_001100367
• UniProt ID: Q61453