Active Recombinant Human Interleukin 17A
Cat.No. : | IL17A-113H |
Product Overview : | Recombinant Human Interleukin 17A encoding the human IL-17A protein sequence (containing the signalpeptide sequence, and the mature IL-17A sequence) was expressed in modified human293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | Interleukin-17 (IL-17) is a 155 amino acid protein that is a disulfide linked, homodimeric,secreted glycoprotein with one N-linked glycosylation site. IL-17 is also referred to as IL-17A. Other members include IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 binds tothe cell surfacer receptor IL-17R. IL-17 is secreted by a subset of T cells called T-helper 17 (Th-17) cells. IL-23 is thought to mediate the production of IL-17 by Th-17 cells. |
Amino Acid Sequence : | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA. |
Molecular Mass : | Under reducing conditions Apollo IL-17A hcx migrates as two bands at approximately 16and 22 kDa on SDS-PAGE due to post-translational modifications. |
pI : | Apollo IL-17A hcx has a predicted pI of 8.62. |
Glycosylation : | Apollo IL-17A hcx contains N--linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-termstorage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended. |
Activity : | The activity of IL-17A is measured by its ability to induce IL-6 production in NHDF cells. The ED50is typically between 0.5 and 1.5 ng/ml. |
Gene Name | 17A interleukin 17A [ Homo sapiens ] |
Synonyms | IL17A; interleukin 17A; IL17; CTLA8; IL-17; IL-17A; toxic T-lymphocyte-associated antigen 8; otoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8) |
Gene ID | 3605 |
mRNA Refseq | NM_002190 |
Protein Refseq | NP_002181 |
UniProt ID | Q16552 |
Chromosome Location | 6p12 |
MIM | 603149 |
Pathway | Cytokine-cytokine receptor interaction |
Function | cytokine activity |
◆ Recombinant Proteins | ||
IL17A-491H | Active Recombinant Human IL-17A Protein, His-tagged | +Inquiry |
IL17A-3093R | Recombinant Rabbit IL17A protein, GST-tagged | +Inquiry |
IL17A-26H | Recombinant Human Interleukin-17 | +Inquiry |
IL17A-001H | Active Recombinant Mouse Interleukin 17A, MIgG2a Fc-tagged | +Inquiry |
IL17A-122H | Recombinant Human IL17A protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket