Recombinant Rat HMOX1 Protein (1-289 aa), His-tagged

Cat.No. : HMOX1-2493R
Product Overview : Recombinant Rat HMOX1 Protein (1-289 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 1-289 aa
Description : Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.0 kDa
AA Sequence : MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Hmox1 heme oxygenase (decycling) 1 [ Rattus norvegicus ]
Official Symbol HMOX1
Synonyms HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; Ho1; Heox; Hmox; Ho-1; HEOXG; hsp32;
Gene ID 24451
mRNA Refseq NM_012580
Protein Refseq NP_036712
UniProt ID P06762

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HMOX1 Products

Required fields are marked with *

My Review for All HMOX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon