Recombinant Rat HMOX1 Protein (1-289 aa), His-tagged

• Cat.No.: HMOX1-2493R
• Product Overview: Recombinant Rat HMOX1 Protein (1-289 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Description: Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
• Source: Yeast
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.0 kDa
• Protein length: 1-289 aa
• AA Sequence: MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Hmox1 heme oxygenase (decycling) 1 [ Rattus norvegicus ]
• Official Symbol: HMOX1
• Synonyms: HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; Ho1; Heox; Hmox; Ho-1; HEOXG; hsp32
• Gene ID: 24451
• mRNA Refseq: NM_012580
• Protein Refseq: NP_036712
• UniProt ID: P06762