Recombinant Rat Fxn Protein, His-tagged
Cat.No. : | Fxn-1218R |
Product Overview : | Recombinant Rat Fxn Protein (41-208aa) was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-208 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFED LADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSL HELLARELTEALNTKLDLSSLAYSGKGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Fxn frataxin [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Fxn |
Synonyms | RGD1565754; Fxn; Frataxin, mitochondrial; EC 1.16.3.1; Frataxin intermediate form; Frataxin mature form |
Gene ID | 499335 |
mRNA Refseq | NM_001191952.1 |
Protein Refseq | NP_001178881.1 |
UniProt ID | D3ZYW7 |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fxn Products
Required fields are marked with *
My Review for All Fxn Products
Required fields are marked with *
0
Inquiry Basket