Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged

• Cat.No.: FXN-1060M
• Product Overview: Recombinant Cynomolgus Monkey (Macaca fascicularis) (Crab-eating macaque) FXN Protein (81-210 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Promotes the biosynthesis of he and assbly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 18.2 kDa
• Protein length: 81-210 aa
• AA Sequence: SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• UniProt ID: Q8HXX9