Recombinant Full Length Human FXN Protein, GST-tagged

• Cat.No.: FXN-5271HF
• Product Overview: Human FXN full-length ORF ( AAH48097.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq
• Molecular Mass: 49.5 kDa
• Protein length: 210 amino acids
• AA Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FXN frataxin [ Homo sapiens ]
• Official Symbol: FXN
• Synonyms: FXN; frataxin; FRDA, Friedreich ataxia; frataxin, mitochondrial; CyaY; FA; FARR; X25; Friedreich ataxia protein; FRDA; MGC57199
• Gene ID: 2395
• mRNA Refseq: NM_000144
• Protein Refseq: NP_000135
• MIM: 606829
• UniProt ID: Q16595