Recombinant Rat Dbi protein, His&Myc-tagged

• Cat.No.: Dbi-2801R
• Product Overview: Recombinant Rat Dbi protein(P11030)(2-87aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-87aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.9 kDa
• AA Sequence: SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Dbi diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [ Rattus norvegicus ]
• Official Symbol: Dbi
• Synonyms: DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); acyl-CoA-binding protein; LRRGT00046; endozepine; octadecaneuropeptide; GABA receptor modulator; diazepam-binding inhibitor; triakontatetraneuropeptide; Diazepam binding inhibitor (GABA receptor modulator acyl-Coenxyme A binding protein); Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenxyme A binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); Ep; Odn; Ttn; Acbp; Acoabp3; RNACOABP3
• Gene ID: 25045
• mRNA Refseq: NM_031853
• Protein Refseq: NP_114054