Recombinant Rat Dbi protein, His&Myc-tagged

Cat.No. : Dbi-2801R
Product Overview : Recombinant Rat Dbi protein(P11030)(2-87aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&Myc
Protein Length : 2-87aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 16.9 kDa
AA Sequence : SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Dbi diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [ Rattus norvegicus ]
Official Symbol Dbi
Synonyms DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); acyl-CoA-binding protein; LRRGT00046; endozepine; octadecaneuropeptide; GABA receptor modulator; diazepam-binding inhibitor; triakontatetraneuropeptide; Diazepam binding inhibitor (GABA receptor modulator acyl-Coenxyme A binding protein); Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenxyme A binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); Ep; Odn; Ttn; Acbp; Acoabp3; RNACOABP3;
Gene ID 25045
mRNA Refseq NM_031853
Protein Refseq NP_114054

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Dbi Products

Required fields are marked with *

My Review for All Dbi Products

Required fields are marked with *

0

Inquiry Basket

cartIcon