Recombinant Human DBI protein, GST-tagged

• Cat.No.: DBI-301619H
• Product Overview: Recombinant Human DBI (1-102 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Tyr102
• AA Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKY
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DBI diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [ Homo sapiens ]
• Official Symbol: DBI
• Synonyms: DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl Coenzyme A binding protein); acyl-CoA-binding protein; ACBD1; ACBP; endozepine; GABA receptor modulator; diazepam-binding inhibitor; acyl coenzyme A binding protein; acyl-Coenzyme A binding domain containing 1; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); EP; CCK-RP; MGC70414
• Gene ID: 1622
• mRNA Refseq: NM_001079862
• Protein Refseq: NP_001073331
• MIM: 125950
• UniProt ID: P07108