Recombinant Mouse Dbi protein, His-tagged

• Cat.No.: Dbi-5643M
• Product Overview: Recombinant Mouse Dbi protein(P31786)(2-87aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Source: Yeast
• Species: Mouse
• Tag: N-His
• Protein length: 2-87aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 11.9 kDa
• AASequence: SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Dbi diazepam binding inhibitor [ Mus musculus ]
• Official Symbol: Dbi
• Synonyms: DBI; diazepam binding inhibitor; acyl-CoA-binding protein; acyl-CoA binding protein; diazepam-binding inhibitor; diazepam binding inhibitor, splice form 1b; EP; Acbp; ACBD1; endozepine
• Gene ID: 13167
• mRNA Refseq: NM_001037999
• Protein Refseq: NP_001033088