Recombinant Rat Cxcl3 protein
Cat.No. : | Cxcl3-627R |
Product Overview : | Recombinant Rat Cxcl3 beta protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 68 |
Description : | CXCL3 is belonging to the CXC chemokine family, which is also known as CINC-2 in rat, DCIP-1 in murine, and GROγ in humans. The functional receptor for CXCL3 has been identified as CXCR2. Similar to other GRO proteins, CXCL3 is potent neutrophil attractants and activators. This chemokine were originally purified from the conditioned medium of rat granulation tissue. In rat, CINC-2 has two isoforms, known as CXCL3α/CINC-2α and CXCL3β/CINC-2β. CXCL3α differs from CXCL3β as DKSS to PSL (98-101) at carboxy-terminal residues. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 5-50 ng/ml. |
Molecular Mass : | Approximately 7.6 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. |
AA Sequence : | RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSPSL |
Endotoxin : | Less than 1 EU/μg of rRtCINC-2β/CXCL3 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cxcl3 |
Official Symbol | Cxcl3 |
Synonyms | CXCL3; chemokine (C-X-C motif) ligand 3; C-X-C motif chemokine 3; MIP2-alpha/beta; macrophage inflammatory protein 2-alpha/beta; cytokine-induced neutrophil chemoattractant 2; cytokine-induced neutrophil chemoattractant-2; Cinc2; Cinc-2; Gm1960; |
Gene ID | 171551 |
mRNA Refseq | NM_138522 |
Protein Refseq | NP_612531 |
UniProt ID | Q10746 |
◆ Recombinant Proteins | ||
CXCL3-2288HF | Recombinant Full Length Human CXCL3 Protein, GST-tagged | +Inquiry |
Cxcl3-349M | Recombinant Mouse Cxcl3 protein, His-tagged | +Inquiry |
CXCL3-18H | Active Recombinant Human CXCL3 | +Inquiry |
Cxcl3-7390M | Recombinant Mouse Cxcl3 Protein, His-tagged | +Inquiry |
Cxcl3-627R | Recombinant Rat Cxcl3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl3 Products
Required fields are marked with *
My Review for All Cxcl3 Products
Required fields are marked with *
0
Inquiry Basket