Active Recombinant Rat Cxcl3 Protein (68 aa)
Cat.No. : | Cxcl3-297C |
Product Overview : | Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Protein Length : | 68 |
Description : | Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of rat CINC-2α/CXCL3 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/mL. |
Molecular Mass : | 7.6 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Cxcl3 chemokine (C-X-C motif) ligand 3 [ Rattus norvegicus ] |
Official Symbol | Cxcl3 |
Synonyms | CXCL3; chemokine (C-X-C motif) ligand 3; C-X-C motif chemokine 3; MIP2-alpha/beta; macrophage inflammatory protein 2-alpha/beta; cytokine-induced neutrophil chemoattractant 2; cytokine-induced neutrophil chemoattractant-2; Cinc2; Cinc-2; Gm1960; |
Gene ID | 171551 |
mRNA Refseq | NM_138522 |
Protein Refseq | NP_612531 |
UniProt ID | Q9EP62 |
◆ Recombinant Proteins | ||
CXCL3-18H | Active Recombinant Human CXCL3 | +Inquiry |
Cxcl3-610M | Recombinant Mouse Cxcl3 protein | +Inquiry |
CXCL3-235H | Active Recombinant Mouse Chemokine (C-X-C motif) Ligand 3, MIgG2a Fc-tagged | +Inquiry |
CXCL3-163H | Recombinant Human Chemokine (C-X-C motif) ligand 3, MBP-tagged | +Inquiry |
CXCL3-2102H | Recombinant Human CXCL3 Protein (Ala35-Asn107), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl3 Products
Required fields are marked with *
My Review for All Cxcl3 Products
Required fields are marked with *
0
Inquiry Basket