Recombinant Rat Cd74 protein, His-tagged

• Cat.No.: Cd74-2672R
• Product Overview: Recombinant Rat Cd74 protein(P10247)(57-280aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Rat
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.5 kDa
• Protein length: 57-280aa
• AA Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cd74 Cd74 molecule, major histocompatibility complex, class II invariant chain [ Rattus norvegicus ]
• Official Symbol: Cd74
• Synonyms: CD74; Cd74 molecule, major histocompatibility complex, class II invariant chain; H-2 class II histocompatibility antigen gamma chain; ii; ia antigen-associated invariant chain; MHC class II-associated invariant chain; INVG34
• Gene ID: 25599
• mRNA Refseq: NM_013069
• Protein Refseq: NP_037201