Recombinant Rat Ccl24 protein
Cat.No. : | Ccl24-638R |
Product Overview : | Recombinant Rat Ccl24 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | CCL24, also named MPIF-2, Eotaxin-2 and Ckβ6, is a novel CC chemokine recently identified. It is a secreted protein, encoded by CCL24 gene, and produced by activated monocytes and T lymphocytes. CCL24 signals through the CCR3 receptor and has functions of chemotactic activity for resting T-lymphocytes and eosinophils, but none for monocytes and activated lymphocytes. The plasma levels of CCL24 and the aspirin-exacerbated respiratory disease (such as asthma) morbidity rate have positive correlation. |
Source : | E.coli |
Species : | Rat |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-250 ng/ml. |
Molecular Mass : | Approximately 10.5 kDa, a single non-glycosylated polypeptide chain consisting of an N-terminal Methionine and the mature rat Eotaxin-2. |
Protein length : | 98 |
AA Sequence : | MPTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV |
Endotoxin : | Less than 1 EU/µg of rRtEotaxin-2/CCL24 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Tag : | Non |
Gene Name | Ccl24 |
Official Symbol | Ccl24 |
Synonyms | CCL24; chemokine (C-C motif) ligand 24; C-C motif chemokine 24; eotaxin-2; eotaxin-2-like protein; eosinophil chemotactic protein 2; |
Gene ID | 288593 |
mRNA Refseq | NM_001013045 |
Protein Refseq | NP_001013063 |
UniProt ID | Q5PPP2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ccl24 Products
Required fields are marked with *
My Review for All Ccl24 Products
Required fields are marked with *
0
Inquiry Basket