Active Recombinant Human CCL24 Protein (78 aa)
Cat.No. : | CCL24-128C |
Product Overview : | Recombinant Human CCL24 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Eotaxin, also named MPIF-2 and Ckβ6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which also includes a C-terminal truncation, contains 78 amino acid residues (92 a.a. residues for the murine homolog, without C-terminal truncation). |
Source : | E. coli |
Species : | Human |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood eosinophils using a concentration range of 50.0 -100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids. |
Protein length : | 78 |
AA Sequence : | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA |
Endotoxin : | Less than 1 EU/mg of rHuEotaxin-2/CCL24 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL24 chemokine (C-C motif) ligand 24 [ Homo sapiens ] |
Official Symbol | CCL24 |
Synonyms | CCL24; chemokine (C-C motif) ligand 24; SCYA24, small inducible cytokine subfamily A (Cys Cys), member 24; C-C motif chemokine 24; CK beta 6; Ckb 6; eotaxin 2; MPIF 2; MPIF2; myeloid progenitor inhibitory factor 2; CK-beta-6; eotaxin-2; small-inducible cytokine A24; eosinophil chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 24; Ckb-6; MPIF-2; SCYA24; |
Gene ID | 6369 |
mRNA Refseq | NM_002991 |
Protein Refseq | NP_002982 |
MIM | 602495 |
UniProt ID | O00175 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CCL24 Products
Required fields are marked with *
My Review for All CCL24 Products
Required fields are marked with *
0
Inquiry Basket