Recombinant Human CCL24 protein

Cat.No. : CCL24-207H
Product Overview : Recombinant Human CCL24 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CCL24 is a secreted protein, encoded by CCL24 gene in humans located on Chr.7, and produced by activated monocytes and T lymphocytes. CCL24 has functions of chemotactic activity for resting T-lymphocytes and eosinophils, but none for monocytes and activated lymphocytes. The plasma levels of CCL24 and the aspirin-exacerbated respiratory disease (such as asthma) morbidity rate have positive correlation.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-100 ng/ml.
Molecular Mass : Approximately 8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
Protein length : 78
AA Sequence : VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
Endotoxin : Less than 1 EU/μg of rHuEotaxin-2/CCL24 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag : Non
Gene Name CCL24
Official Symbol CCL24
Synonyms CCL24; chemokine (C-C motif) ligand 24; SCYA24, small inducible cytokine subfamily A (Cys Cys), member 24; C-C motif chemokine 24; CK beta 6; Ckb 6; eotaxin 2; MPIF 2; MPIF2; myeloid progenitor inhibitory factor 2; CK-beta-6; eotaxin-2; small-inducible cytokine A24; eosinophil chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 24; Ckb-6; MPIF-2; SCYA24;
Gene ID 6369
mRNA Refseq NM_002991
Protein Refseq NP_002982
MIM 602495
UniProt ID O00175

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL24 Products

Required fields are marked with *

My Review for All CCL24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon