Recombinant Rat Atf4 protein, His&Myc-tagged
Cat.No. : | Atf4-184R |
Product Overview : | Recombinant Rat Atf4 protein(Q9ES19)(1-347aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-347aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.2 kDa |
AA Sequence : | MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atf4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Rattus norvegicus ] |
Official Symbol | Atf4 |
Synonyms | ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); cyclic AMP-dependent transcription factor ATF-4; rATF-4; activating transcription factor ATF-4; cAMP-dependent transcription factor ATF-4; |
Gene ID | 79255 |
mRNA Refseq | NM_024403 |
Protein Refseq | NP_077379 |
◆ Recombinant Proteins | ||
ATF4-813M | Recombinant Mouse ATF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATF4-939H | Recombinant Human ATF4 protein, GST-tagged | +Inquiry |
ATF4-0291H | Recombinant Human ATF4 Protein (Met1-Pro351), N-His-tagged | +Inquiry |
Atf4-183R | Recombinant Rat Atf4 protein, His&Myc-tagged | +Inquiry |
ATF4-1074HF | Recombinant Full Length Human ATF4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Atf4 Products
Required fields are marked with *
My Review for All Atf4 Products
Required fields are marked with *
0
Inquiry Basket