Recombinant Rat Atf4 protein, His&Myc-tagged

• Cat.No.: Atf4-184R
• Product Overview: Recombinant Rat Atf4 protein(Q9ES19)(1-347aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 1-347aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.2 kDa
• AA Sequence: MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Atf4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Rattus norvegicus ]
• Official Symbol: Atf4
• Synonyms: ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); cyclic AMP-dependent transcription factor ATF-4; rATF-4; activating transcription factor ATF-4; cAMP-dependent transcription factor ATF-4
• Gene ID: 79255
• mRNA Refseq: NM_024403
• Protein Refseq: NP_077379