Recombinant Rat APOC3 Protein (21-101 aa), His-tagged

• Cat.No.: APOC3-1333R
• Product Overview: Recombinant Rat APOC3 Protein (21-101 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 21-101 aa
• Description: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.0 kDa
• AA Sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Apoc3 apolipoprotein C-III [ Rattus norvegicus ]
• Official Symbol: APOC3
• Synonyms: APOC3; apolipoprotein C-3; ApoC-III; apo-CIII
• Gene ID: 24207
• mRNA Refseq: NM_012501
• Protein Refseq: NP_036633
• UniProt ID: P06759