Recombinant Rat Alpi protein(21-511aa), His-tagged

• Cat.No.: Alpi-654R
• Product Overview: Recombinant Rat Alpi protein(P15693)(21-511aa), fused with N-terminal His tag, was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 21-511aa
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH10.0. The specific activity is >10370.37 U/mg.
• Molecular Mass: 55.9 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN

Gene Information

• Gene Name: Alpi alkaline phosphatase, intestinal [ Rattus norvegicus ]
• Official Symbol: Alpi
• Synonyms: ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase 1; IAP-1; IAP-I; intestinal alkaline phosphatase 1; intestinal alkaline phosphatase I IAP-I; Alkaline phosphatase 1, intestinal, defined by SSR; Alp1; S51097
• Gene ID: 24197
• mRNA Refseq: NM_022665
• Protein Refseq: NP_073156