Recombinant Rat Alpi protein(21-511aa), His-tagged

Source :	HEK293
Species :	Rat
Tag :	His
Protein length :	21-511aa
Form :	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Bio-activity :	Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH10.0. The specific activity is >10370.37 U/mg.
Molecular Mass :	55.9 kDa
AASequence :	VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
Endotoxin :	Less than 1.0 EU/ug as determined by LAL method.
Purity :	Greater than 95% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Name	Alpi alkaline phosphatase, intestinal [ Rattus norvegicus ]
Official Symbol	Alpi
Synonyms	ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase 1; IAP-1; IAP-I; intestinal alkaline phosphatase 1; intestinal alkaline phosphatase I IAP-I; Alkaline phosphatase 1, intestinal, defined by SSR; Alp1; S51097;
Gene ID	24197
mRNA Refseq	NM_022665
Protein Refseq	NP_073156