Recombinant Full Length Human ALPI Protein, C-Flag-tagged
Cat.No. : | ALPI-69HFL |
Product Overview : | Recombinant Full Length Human ALPI Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTA TRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQC NTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLI SNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQS VTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEA VMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY TACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Folate biosynthesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ALPI alkaline phosphatase, intestinal [ Homo sapiens (human) ] |
Official Symbol | ALPI |
Synonyms | IAP |
Gene ID | 248 |
mRNA Refseq | NM_001631.5 |
Protein Refseq | NP_001622.2 |
MIM | 171740 |
UniProt ID | P09923 |
◆ Recombinant Proteins | ||
ALPI-1326H | Recombinant Human ALPI Protein (20-503 aa), His-tagged | +Inquiry |
Alpi-654R | Recombinant Rat Alpi protein(21-511aa), His-tagged | +Inquiry |
ALPI-490H | Recombinant Human ALPI Protein, GST-tagged | +Inquiry |
ALPI-326H | Recombinant Human ALPI Protein, His (Fc)-Avi-tagged | +Inquiry |
ALPI-024H | Recombinant Human ALPI Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
ALPI-8348B | Native Bovine ALPI | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
IAP-8323C | Active Native Bovine IAP | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALPI Products
Required fields are marked with *
My Review for All ALPI Products
Required fields are marked with *
0
Inquiry Basket