Recombinant Rabbit IFN gamma
Cat.No. : | IFNg-28R |
Product Overview : | Rabbit IFN gamma was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Tag : | Non |
Description : | Interferon-gamma (IFN-gamma) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops. |
Form : | Lyophilized |
Molecular Mass : | 16.9 kDa |
AA Sequence : | QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVS FYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNL TRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRG RRASKY (144) |
Applications : | The rabbit IFN gamma protein can be used in cell culture, as a IFN gamma ELISA Standard, and as a Western Blot Control. |
Storage : | -20 C |
Gene Name | IFNG interferon, gamma [ Oryctolagus cuniculus ] |
Official Symbol | IFNg |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN gamma; IFN-gamma; |
Gene ID | 100008602 |
mRNA Refseq | NM_001081991 |
Protein Refseq | NP_001075460 |
◆ Recombinant Proteins | ||
Ifng-379I | Active Recombinant Mouse Ifng Protein (134 aa) | +Inquiry |
Ifng-114M | Recombinant Mouse Ifng protein | +Inquiry |
IFNG-264I | Active Recombinant Human IFNG Protein | +Inquiry |
IFNG-28243TH | Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-2028R | Recombinant Rhesus Macaque IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNg Products
Required fields are marked with *
My Review for All IFNg Products
Required fields are marked with *
0
Inquiry Basket