Active Recombinant Mouse Ifng Protein (134 aa)

Cat.No. : Ifng-379I
Product Overview : Recombinant mouse IFN gamma (rmIFN-γ) produced in E. coli is a non-glycosylated polypeptide chain of 134 amino acids. A fully biologically active molecule, rmIFN--γ has a molecular mass of 15 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 134
Description : Sharing 41% sequence identity with human Interferon gamma (hIFN--γ), mouse IFN gamma (mIFN--γ)is a macrophage-activating factor.The active form of IFN--γ is an antiparallel dimer that sets off IFN--γ/JAK/STAT pathway. IFN--γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity.While IFN--γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN--γ is also implicated in resistance to NK cell and CTL responses and in immune escape in avariety of cancers.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.15 ng/mL, measured by cytotoxicity assay using WEHI-279 cells.
Molecular Mass : 15 kDa, observed by reducing SDS-PAGE.
AA Sequence : MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by reducing SDS-PAGE.
Storage : Lyophilized recombinant mouse IFN gamma (rmIFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIFN-γ should be stable up to 1week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Ifng interferon gamma [ Mus musculus ]
Official Symbol Ifng
Synonyms IFNG; interferon gamma; IFN-gamma; gamma interferon; Ifg; IFN-g;
Gene ID 15978
mRNA Refseq NM_008337
Protein Refseq NP_032363
UniProt ID P01580

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ifng Products

Required fields are marked with *

My Review for All Ifng Products

Required fields are marked with *

0

Inquiry Basket

cartIcon