Active Recombinant Mouse Ifng Protein (134 aa)
Cat.No. : | Ifng-379I |
Product Overview : | Recombinant mouse IFN gamma (rmIFN-γ) produced in E. coli is a non-glycosylated polypeptide chain of 134 amino acids. A fully biologically active molecule, rmIFN--γ has a molecular mass of 15 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 134 |
Description : | Sharing 41% sequence identity with human Interferon gamma (hIFN--γ), mouse IFN gamma (mIFN--γ)is a macrophage-activating factor.The active form of IFN--γ is an antiparallel dimer that sets off IFN--γ/JAK/STAT pathway. IFN--γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity.While IFN--γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN--γ is also implicated in resistance to NK cell and CTL responses and in immune escape in avariety of cancers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 0.15 ng/mL, measured by cytotoxicity assay using WEHI-279 cells. |
Molecular Mass : | 15 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by reducing SDS-PAGE. |
Storage : | Lyophilized recombinant mouse IFN gamma (rmIFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIFN-γ should be stable up to 1week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ifng interferon gamma [ Mus musculus ] |
Official Symbol | Ifng |
Synonyms | IFNG; interferon gamma; IFN-gamma; gamma interferon; Ifg; IFN-g; |
Gene ID | 15978 |
mRNA Refseq | NM_008337 |
Protein Refseq | NP_032363 |
UniProt ID | P01580 |
◆ Recombinant Proteins | ||
IFNG-805P | Recombinant Pig IFNG protein, His-tagged | +Inquiry |
IFNg-31H | Recombinant Human IFN gamma | +Inquiry |
IFNG-116H | Recombinant Human IFNG protein | +Inquiry |
Ifng-488M | Recombinant Mouse Ifng protein, His-tagged | +Inquiry |
IFNG-7822C | Recombinant Canine IFNG protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *
0
Inquiry Basket