Recombinant Rabbit CLNS1A protein, His&Myc-tagged
Cat.No. : | CLNS1A-535R |
Product Overview : | Recombinant Rabbit CLNS1A protein(Q28678)(2-236aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-236aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SFLKSFPPPGPTEGLRHQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKFGEESKELVADEEEDSDDDVEPISEFRFVPGDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH |
Gene Name | CLNS1A chloride channel, nucleotide-sensitive, 1A [ Oryctolagus cuniculus ] |
Official Symbol | CLNS1A |
Synonyms | CLNS1A; chloride channel, nucleotide-sensitive, 1A; methylosome subunit pICln; chloride channel, nucleotide sensitive 1A; chloride conductance regulatory protein ICln; swelling-induced chloride conductance regulatory protein; ICLN; pIcIn; |
Gene ID | 100008991 |
mRNA Refseq | NM_001171027 |
Protein Refseq | NP_001164498 |
◆ Recombinant Proteins | ||
CLNS1A-3743H | Recombinant Human CLNS1A protein, GST-tagged | +Inquiry |
CLNS1A-1116R | Recombinant Rat CLNS1A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLNS1A-1885HF | Recombinant Full Length Human CLNS1A Protein, GST-tagged | +Inquiry |
CLNS1A-535R | Recombinant Rabbit CLNS1A protein, His&Myc-tagged | +Inquiry |
CLNS1A-360H | Recombinant Human chloride channel, nucleotide-sensitive, 1A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLNS1A-7437HCL | Recombinant Human CLNS1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLNS1A Products
Required fields are marked with *
My Review for All CLNS1A Products
Required fields are marked with *
0
Inquiry Basket