Recombinant Human CLNS1A protein, GST-tagged

• Cat.No.: CLNS1A-3743H
• Product Overview: Recombinant Human CLNS1A protein(1-237 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-237 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CLNS1A chloride channel, nucleotide-sensitive, 1A [ Homo sapiens ]
• Official Symbol: CLNS1A
• Synonyms: CLNS1A; chloride channel, nucleotide-sensitive, 1A; CLCI; methylosome subunit pICln; ICln; i(Cln); reticulocyte pICln; reticulocyte protein ICln; chloride channel regulatory protein; chloride ion current inducer protein; chloride channel, nucleotide sensitive 1A; chloride conductance regulatory protein ICln; CLNS1B
• Gene ID: 1207
• mRNA Refseq: NM_001293
• Protein Refseq: NP_001284
• MIM: 602158
• UniProt ID: P54105