Recombinant Pig IL4R Protein (33-240 aa), His-sumostar-tagged

• Cat.No.: IL4R-2437P
• Product Overview: Recombinant Pig IL4R Protein (33-240 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Description: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
• Source: Yeast
• Species: Pig
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.2 kDa
• Protein length: 33-240 aa
• AA Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: IL4R interleukin 4 receptor [ Sus scrofa ]
• Official Symbol: IL4R
• Synonyms: IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; IL-4RA; IL-4R-alpha; IL-4R subunit alpha
• Gene ID: 397614
• mRNA Refseq: NM_214340
• Protein Refseq: NP_999505
• UniProt ID: Q863Z5