Recombinant P. falciparum HRP II (21-309), His-tagged
Cat.No. : | HRP II-01P |
Product Overview : | Recombinant P. falciparum HRP II with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Plasmodium falciparum |
Source : | E.coli |
Tag : | His |
ProteinLength : | 21-309 |
Form : | Liquid |
Molecular Mass : | Predicted molecular weight: 63 kDa including tags Actual molecular weight: 40 kDa including tags |
AA Sequence : | LDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHAHHVADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHAADAHHAHHASDAHHAADAHHAAYAHHAHHAADAHHAHHASDAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADARHATDAHHAADAHHATDAHHAADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDAHHAHHAADAHHAAAHHATDAHHATDAHHAAAHHEAATHCLRH |
Purity : | > 90% by SDS-PAGE |
Applications : | ELISA, SDS-PAGE, WB |
Storage : | Store at +4 centigrade short term (1-2 weeks). Upon delivery aliquot. Store at -20 centigrade long term. Avoid freeze/thaw cycle. Stable for 12 months at -20 centigrade. |
Storage Buffer : | pH: 7.2 Constituent: PBS |
Preservative : | 0.09% Sodium azide |
Shipping : | Shipped at 4 centigrade. |
Official Symbol | HRP II |
Synonyms | HRP II; Histidine-rich protein II |
UniProt ID | P90582 |
◆ Native Proteins | ||
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDLIM2-3326HCL | Recombinant Human PDLIM2 293 Cell Lysate | +Inquiry |
TSSK1B-694HCL | Recombinant Human TSSK1B 293 Cell Lysate | +Inquiry |
SEC14L1-1999HCL | Recombinant Human SEC14L1 293 Cell Lysate | +Inquiry |
TAT-1238HCL | Recombinant Human TAT 293 Cell Lysate | +Inquiry |
Duodenum-443S | Sheep Duodenum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HRP II Products
Required fields are marked with *
My Review for All HRP II Products
Required fields are marked with *
0
Inquiry Basket