Recombinant Mouse Trim21 protein, His-tagged

• Cat.No.: Trim21-7432M
• Product Overview: Recombinant Mouse Trim21 protein(Q62191)(1-470aa), fused with N-terminal His tag, was expressed in Insect cells.

Specification

• Source: Insect cells
• Species: Mouse
• Tag: N-His
• Protein length: 1-470aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.7 kDa
• AASequence: MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Trim21 tripartite motif-containing 21 [ Mus musculus ]
• Official Symbol: Trim21
• Synonyms: TRIM21; tripartite motif-containing 21; E3 ubiquitin-protein ligase TRIM21; SS-A; ro(SS-A); 52 kDa Ro protein; 52kD Ro/SSA autoantigen; Sjogren syndrome antigen A1; tripartite motif protein 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro52; Ssa1
• Gene ID: 20821
• mRNA Refseq: NM_001082552
• Protein Refseq: NP_001076021