Recombinant Human TRIM21 protein, His-tagged

Cat.No. : TRIM21-3037H
Product Overview : Recombinant Human TRIM21 protein(176-475 aa), fused to His tag, was expressed in E. coli.
Availability March 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 176-475 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TRIM21 tripartite motif containing 21 [ Homo sapiens ]
Official Symbol TRIM21
Synonyms TRIM21; tripartite motif containing 21; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA1, tripartite motif containing 21; E3 ubiquitin-protein ligase TRIM21; RNF81; RO52; SS-A; ro(SS-A); 52 kDa Ro protein; RING finger protein 81; Sicca syndrome antigen A; tripartite motif-containing 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS-A/Ro); SSA; SSA1;
Gene ID 6737
mRNA Refseq NM_003141
Protein Refseq NP_003132
MIM 109092
UniProt ID P19474

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TRIM21 Products

Required fields are marked with *

My Review for All TRIM21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon