Recombinant Mouse Tnc protein, His&Myc-tagged

Cat.No. : Tnc-2326M
Product Overview : Recombinant Mouse Tnc protein(Q80YX1)(1884-2099aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His&Myc
Protein Length : 1884-2099aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.8 kDa
AA Sequence : GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Tnc tenascin C [ Mus musculus ]
Official Symbol Tnc
Synonyms TNC; tenascin C; tenascin; hexabrachion; TN; Hxb; Ten; TN-C; AI528729; cytotactin; tenascin-C; C130033P17Rik; MGC144208; MGC144209;
Gene ID 21923
mRNA Refseq NM_011607
Protein Refseq NP_035737

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Tnc Products

Required fields are marked with *

My Review for All Tnc Products

Required fields are marked with *

0

Inquiry Basket

cartIcon